2'-PDE antibody (70R-2362)

Rabbit polyclonal 2'-PDE antibody raised against the middle region of 2'-Pde

Synonyms Polyclonal 2'-PDE antibody, Anti-2'-PDE antibody, Phosphodiesterase antibody
Specificity 2'-PDE antibody was raised against the middle region of 2'-Pde
Cross Reactivity Human,Mouse
Applications WB
Immunogen 2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW
Assay Information 2'-PDE Blocking Peptide, catalog no. 33R-1734, is also available for use as a blocking control in assays to test for specificity of this 2'-PDE antibody

Images

Western Blot analysis using 2'-PDE antibody (70R-2362)

2'-PDE antibody (70R-2362) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 2'-PDE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using 2'-PDE antibody (70R-2362) | 2'-PDE antibody (70R-2362) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors