A2BP1 antibody (70R-2568)

Rabbit polyclonal Ataxin 2-Binding Protein 1 antibody raised against the N terminal of A2BP1

Synonyms Polyclonal A2BP1 antibody, Anti-A2BP1 antibody, Ataxin 2-Binding Protein 1 antibody
Specificity A2BP1 antibody was raised against the N terminal of A2BP1
Cross Reactivity Human,Mouse
Applications WB
Immunogen A2BP1 antibody was raised using the N terminal of A2BP1 corresponding to a region with amino acids NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
Assay Information A2BP1 Blocking Peptide, catalog no. 33R-6652, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody


Western Blot analysis using A2BP1 antibody (70R-2568)

A2BP1 antibody (70R-2568) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A2BP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using A2BP1 antibody (70R-2568) | A2BP1 antibody (70R-2568) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors