A2BP1 Blocking Peptide (33R-6652)
A synthetic peptide for use as a blocking control in assays to test for specificity of A2BP1 antibody, catalog no. 70R-2568
Overview
Overview
| Synonyms | A2BP1 control peptide, A2BP1 antibody Blocking Peptide, Anti-A2BP1 Blocking Peptide, Ataxin 2-Binding Protein 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE |
|---|---|
| Molecular Weight | 40 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product