AADAC antibody (70R-1875)

Rabbit polyclonal AADAC antibody

Synonyms Polyclonal AADAC antibody, Anti-AADAC antibody, Arylacetamide Deacetylase antibody, DAC antibody, Esterase antibody
Cross Reactivity Human
Applications WB
Immunogen AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL
Assay Information AADAC Blocking Peptide, catalog no. 33R-6939, is also available for use as a blocking control in assays to test for specificity of this AADAC antibody


Western Blot analysis using AADAC antibody (70R-1875)

AADAC antibody (70R-1875) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AADAC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AADAC antibody (70R-1875) | AADAC antibody (70R-1875) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors