AADAC Blocking Peptide (33R-1251)
A synthetic peptide for use as a blocking control in assays to test for specificity of AADAC antibody, catalog no. 70R-7287
Overview
Overview
| Synonyms | AADAC control peptide, AADAC antibody Blocking Peptide, Anti-AADAC Blocking Peptide, Arylacetamide Deacetylase Blocking Peptide, Esterase Blocking Peptide, CES5A1 Blocking Peptide, DAC Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product