AADAC Blocking Peptide (33R-1251)

A synthetic peptide for use as a blocking control in assays to test for specificity of AADAC antibody, catalog no. 70R-7287

Synonyms AADAC control peptide, AADAC antibody Blocking Peptide, Anti-AADAC Blocking Peptide, Arylacetamide Deacetylase Blocking Peptide, Esterase Blocking Peptide, CES5A1 Blocking Peptide, DAC Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors