AADAT antibody (70R-1120)

Rabbit polyclonal AADAT antibody raised against the N terminal of AADAT

Synonyms Polyclonal AADAT antibody, Anti-AADAT antibody, KAT2 antibody, KATII antibody, Aminoadipate Aminotransferase antibody
Specificity AADAT antibody was raised against the N terminal of AADAT
Cross Reactivity Human
Applications IHC, WB
Immunogen AADAT antibody was raised using the N terminal of AADAT corresponding to a region with amino acids AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI
Assay Information AADAT Blocking Peptide, catalog no. 33R-1601, is also available for use as a blocking control in assays to test for specificity of this AADAT antibody

Images

Western Blot analysis using AADAT antibody (70R-1120)

AADAT antibody (70R-1120) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AADAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AADAT antibody (70R-1120) | AADAT antibody (70R-1120) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors