ABHD13 Blocking Peptide (33R-8762)
A synthetic peptide for use as a blocking control in assays to test for specificity of ABHD13 antibody, catalog no. 70R-6949
Overview
Overview
| Synonyms | ABHD13 control peptide, ABHD13 antibody Blocking Peptide, Anti-ABHD13 Blocking Peptide, Abhydrolase Domain Containing 13 Blocking Peptide, BEM46L1 Blocking Peptide, C13orf6 Blocking Peptide, FLJ14906 Blocking Peptide, MGC27058 Blocking Peptide, RP11-153I24.2 Blocking Peptide, bA153I24.2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product