ABHD13 Blocking Peptide (33R-8762)

A synthetic peptide for use as a blocking control in assays to test for specificity of ABHD13 antibody, catalog no. 70R-6949

Synonyms ABHD13 control peptide, ABHD13 antibody Blocking Peptide, Anti-ABHD13 Blocking Peptide, Abhydrolase Domain Containing 13 Blocking Peptide, BEM46L1 Blocking Peptide, C13orf6 Blocking Peptide, FLJ14906 Blocking Peptide, MGC27058 Blocking Peptide, RP11-153I24.2 Blocking Peptide, bA153I24.2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors