ABP1 antibody (70R-5440)

Rabbit polyclonal ABP1 antibody raised against the C terminal of ABP1

Synonyms Polyclonal ABP1 antibody, Anti-ABP1 antibody, DAO antibody, DAO1 antibody, ABP antibody, Amiloride Binding Protein 1 antibody, KAO antibody, Amine Oxidase antibody, AOC1 antibody
Specificity ABP1 antibody was raised against the C terminal of ABP1
Cross Reactivity Human
Applications IHC, WB
Immunogen ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF
Assay Information ABP1 Blocking Peptide, catalog no. 33R-7547, is also available for use as a blocking control in assays to test for specificity of this ABP1 antibody


Immunohistochemical staining using ABP1 antibody (70R-5440)

ABP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABP1 is a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ABP1 antibody (70R-5440) | ABP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ABP1 antibody (70R-5440) | ABP1 antibody (70R-5440) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using ABP1 antibody (70R-5440) | ABP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors