ABRA Blocking Peptide (33R-7785)
A synthetic peptide for use as a blocking control in assays to test for specificity of ABRA antibody, catalog no. 70R-9194
Overview
Overview
| Synonyms | ABRA control peptide, ABRA antibody Blocking Peptide, Anti-ABRA Blocking Peptide, actin-binding Rho activating protein Blocking Peptide, STARS Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ABRA acts as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nuclear translocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product