ABRA Blocking Peptide (33R-7785)

A synthetic peptide for use as a blocking control in assays to test for specificity of ABRA antibody, catalog no. 70R-9194

Synonyms ABRA control peptide, ABRA antibody Blocking Peptide, Anti-ABRA Blocking Peptide, actin-binding Rho activating protein Blocking Peptide, STARS Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABRA acts as an activator of serum response factor (SRF)-dependent transcription possibly by inducing nuclear translocation of MKL1 or MKL2 and through a mechanism requiring Rho-actin signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors