AC antibody (70R-1978)

Rabbit polyclonal AC antibody raised against the N terminal Of Ac

Synonyms Polyclonal AC antibody, Anti-AC antibody, Hw antibody, ascT5 antibody, 990 E5 F1 antibody, CG3796 antibody, T5 antibody, AS-C T5ac antibody, EG:125H10.3 antibody, ASC antibody, sc/T5 antibody, AS-C T5 antibody
Specificity AC antibody was raised against the N terminal Of Ac
Cross Reactivity Drosophila
Applications WB
Immunogen AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
Assay Information AC Blocking Peptide, catalog no. 33R-3003, is also available for use as a blocking control in assays to test for specificity of this AC antibody

Images

Western Blot analysis using AC antibody (70R-1978)

AC antibody (70R-1978) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of AC protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AC antibody (70R-1978) | AC antibody (70R-1978) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors