ACAA2 antibody (70R-2493)

Rabbit polyclonal ACAA2 antibody raised against the N terminal of ACAA2

Synonyms Polyclonal ACAA2 antibody, Anti-ACAA2 antibody, Acetyl-Coenzyme A Acyltransferase 2 antibody, DSAEC antibody
Specificity ACAA2 antibody was raised against the N terminal of ACAA2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV
Assay Information ACAA2 Blocking Peptide, catalog no. 33R-1355, is also available for use as a blocking control in assays to test for specificity of this ACAA2 antibody


Western Blot analysis using ACAA2 antibody (70R-2493)

ACAA2 antibody (70R-2493) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACAA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACAA2 antibody (70R-2493) | ACAA2 antibody (70R-2493) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors