ACADL antibody (70R-2543)

Rabbit polyclonal ACADL antibody raised against the N terminal of ACADL

Synonyms Polyclonal ACADL antibody, Anti-ACADL antibody, ACAD4 antibody, LCAD antibody, Acyl-Coenzyme A Dehydrogenase Long Chain antibody
Specificity ACADL antibody was raised against the N terminal of ACADL
Cross Reactivity Human
Applications WB
Immunogen ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR
Assay Information ACADL Blocking Peptide, catalog no. 33R-5609, is also available for use as a blocking control in assays to test for specificity of this ACADL antibody

Images

Western Blot analysis using ACADL antibody (70R-2543)

ACADL antibody (70R-2543) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACADL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACADL antibody (70R-2543) | ACADL antibody (70R-2543) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors