DVL1 Blocking Peptide (33R-1019)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACADM antibody, catalog no. 70R-2483

Synonyms ACADM control peptide, ACADM antibody Blocking Peptide, Anti-ACADM Blocking Peptide, Acyl-Coenzyme A Dehydrogenase C-4 To C-12 Straight Chain Blocking Peptide, ACAD1 Blocking Peptide, MCAD Blocking Peptide, MCADH Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors