DVL1 Blocking Peptide (33R-1019)
A synthetic peptide for use as a blocking control in assays to test for specificity of ACADM antibody, catalog no. 70R-2483
Overview
Overview
| Synonyms | ACADM control peptide, ACADM antibody Blocking Peptide, Anti-ACADM Blocking Peptide, Acyl-Coenzyme A Dehydrogenase C-4 To C-12 Straight Chain Blocking Peptide, ACAD1 Blocking Peptide, MCAD Blocking Peptide, MCADH Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product