ACADS antibody (70R-2317)

Rabbit polyclonal ACADS antibody raised against the middle region of ACADS

Synonyms Polyclonal ACADS antibody, Anti-ACADS antibody, ACAD3 antibody, SCAD antibody, Acyl-Coenzyme A Dehydrogenase C-2 To C-3 Short Chain antibody
Specificity ACADS antibody was raised against the middle region of ACADS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACADS antibody was raised using the middle region of ACADS corresponding to a region with amino acids FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA
Assay Information ACADS Blocking Peptide, catalog no. 33R-3100, is also available for use as a blocking control in assays to test for specificity of this ACADS antibody

Images

Western Blot analysis using ACADS antibody (70R-2317)

ACADS antibody (70R-2317) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACADS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACADS antibody (70R-2317) | ACADS antibody (70R-2317) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors