ACADVL Blocking Peptide (33R-3923)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACADVL antibody, catalog no. 70R-9269

Synonyms ACADVL control peptide, ACADVL antibody Blocking Peptide, Anti-ACADVL Blocking Peptide, acyl-Coenzyme A dehydrogenase, very long chain Blocking Peptide, ACAD6 Blocking Peptide, LCACD Blocking Peptide, VLCAD Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ
Molecular Weight 64 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors