ACADVL Blocking Peptide (33R-3923)
A synthetic peptide for use as a blocking control in assays to test for specificity of ACADVL antibody, catalog no. 70R-9269
Overview
Overview
| Synonyms | ACADVL control peptide, ACADVL antibody Blocking Peptide, Anti-ACADVL Blocking Peptide, acyl-Coenzyme A dehydrogenase, very long chain Blocking Peptide, ACAD6 Blocking Peptide, LCACD Blocking Peptide, VLCAD Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ |
|---|---|
| Molecular Weight | 64 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product