ACAT2 Blocking Peptide (33R-9686)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT2 antibody, catalog no. 70R-1083

Synonyms ACAT2 control peptide, ACAT2 antibody Blocking Peptide, Anti-ACAT2 Blocking Peptide, Acetyl-Coenzyme A Acetyltransferase 2 Blocking Peptide, ACAT2, ACAT-2, ACAT 2, ACAT-2 Blocking Peptide, ACAT 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS
Molecular Weight 44 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors