ACAT2 Blocking Peptide (33R-9686)
A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT2 antibody, catalog no. 70R-1083
Overview
Overview
| Synonyms | ACAT2 control peptide, ACAT2 antibody Blocking Peptide, Anti-ACAT2 Blocking Peptide, Acetyl-Coenzyme A Acetyltransferase 2 Blocking Peptide, ACAT2, ACAT-2, ACAT 2, ACAT-2 Blocking Peptide, ACAT 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS |
|---|---|
| Molecular Weight | 44 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product