ACD Blocking Peptide (33R-4573)
A synthetic peptide for use as a blocking control in assays to test for specificity of ACD antibody, catalog no. 70R-2904
Overview
Overview
| Synonyms | ACD control peptide, ACD antibody Blocking Peptide, Anti-ACD Blocking Peptide, Adrenocortical Dysplasia Homolog Blocking Peptide, PIP1 Blocking Peptide, PTOP Blocking Peptide, TINT1 Blocking Peptide, TPP1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ |
|---|---|
| Molecular Weight | 58 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product