ACD Blocking Peptide (33R-4573)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACD antibody, catalog no. 70R-2904

Synonyms ACD control peptide, ACD antibody Blocking Peptide, Anti-ACD Blocking Peptide, Adrenocortical Dysplasia Homolog Blocking Peptide, PIP1 Blocking Peptide, PTOP Blocking Peptide, TINT1 Blocking Peptide, TPP1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ
Molecular Weight 58 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACD is a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors