ACMSD Blocking Peptide (33R-6822)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACMSD antibody, catalog no. 70R-6311

Synonyms ACMSD control peptide, ACMSD antibody Blocking Peptide, Anti-ACMSD Blocking Peptide, Aminocarboxymuconate Semialdehyde Decarboxylase Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors