ACMSD Blocking Peptide (33R-6822)
A synthetic peptide for use as a blocking control in assays to test for specificity of ACMSD antibody, catalog no. 70R-6311
Overview
Overview
| Synonyms | ACMSD control peptide, ACMSD antibody Blocking Peptide, Anti-ACMSD Blocking Peptide, Aminocarboxymuconate Semialdehyde Decarboxylase Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product