ACO2 antibody (70R-2446)

Rabbit polyclonal ACO2 antibody raised against the middle region of ACO2

Synonyms Polyclonal ACO2 antibody, Anti-ACO2 antibody, Aconitase 2 Mitochondrial antibody, MGC33908 antibody, MGC20605 antibody, ACONM antibody
Specificity ACO2 antibody was raised against the middle region of ACO2
Cross Reactivity Human,Mouse,Rat,C.elegans
Applications WB
Immunogen ACO2 antibody was raised using the middle region of ACO2 corresponding to a region with amino acids RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET
Assay Information ACO2 Blocking Peptide, catalog no. 33R-8284, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Images

Western Blot analysis using ACO2 antibody (70R-2446)

ACO2 antibody (70R-2446) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACO2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACO2 antibody (70R-2446) | ACO2 antibody (70R-2446) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors