ACP5 antibody (70R-3911)

Rabbit polyclonal ACP5 antibody raised against the N terminal of ACP5

Synonyms Polyclonal ACP5 antibody, Anti-ACP5 antibody, Acid Phosphatase 5 Tartrate Resistant antibody, MGC117378 antibody, TRAP antibody
Specificity ACP5 antibody was raised against the N terminal of ACP5
Cross Reactivity Human
Applications WB
Immunogen ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
Assay Information ACP5 Blocking Peptide, catalog no. 33R-2079, is also available for use as a blocking control in assays to test for specificity of this ACP5 antibody

Images

Western Blot analysis using ACP5 antibody (70R-3911)

ACP5 antibody (70R-3911) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACP5 antibody (70R-3911) | ACP5 antibody (70R-3911) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors