ACP6 antibody (70R-2691)

Rabbit polyclonal ACP6 antibody raised against the N terminal of ACP6

Synonyms Polyclonal ACP6 antibody, Anti-ACP6 antibody, LPAP antibody, ACPL1 antibody, Acid Phosphatase 6 Lysophosphatidic antibody, PACPL1 antibody
Specificity ACP6 antibody was raised against the N terminal of ACP6
Cross Reactivity Human
Applications WB
Immunogen ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA
Assay Information ACP6 Blocking Peptide, catalog no. 33R-2681, is also available for use as a blocking control in assays to test for specificity of this ACP6 antibody


Western Blot analysis using ACP6 antibody (70R-2691)

ACP6 antibody (70R-2691) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACP6 antibody (70R-2691) | ACP6 antibody (70R-2691) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors