ACSBG2 antibody (70R-2598)

Rabbit polyclonal ACSBG2 antibody raised against the middle region of ACSBG2

Synonyms Polyclonal ACSBG2 antibody, Anti-ACSBG2 antibody, Acyl-Coa Synthetase Bubblegum Family Member 2 antibody, PRTD-NY3 antibody, BRGL antibody, DKFZp434K1635 antibody, BGR antibody, MGC111089 antibody
Specificity ACSBG2 antibody was raised against the middle region of ACSBG2
Cross Reactivity Human
Applications WB
Immunogen ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK
Assay Information ACSBG2 Blocking Peptide, catalog no. 33R-5237, is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody


Western Blot analysis using ACSBG2 antibody (70R-2598)

ACSBG2 antibody (70R-2598) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACSBG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACSBG2 antibody (70R-2598) | ACSBG2 antibody (70R-2598) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors