ACSL5 Blocking Peptide (33R-1075)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL5 antibody, catalog no. 70R-6556

Synonyms ACSL5 control peptide, ACSL5 antibody Blocking Peptide, Anti-ACSL5 Blocking Peptide, Acyl-Coa Synthetase Long-Chain Family Member 5 Blocking Peptide, ACS2 Blocking Peptide, ACS5 Blocking Peptide, FACL5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG
Molecular Weight 76 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors