ACSS2 Blocking Peptide (33R-10369)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACSS2 antibody, catalog no. 70R-10248

Synonyms ACSS2 control peptide, ACSS2 antibody Blocking Peptide, Anti-ACSS2 Blocking Peptide, acyl-CoA synthetase short-chain family member 2 Blocking Peptide, ACAS2 Blocking Peptide, ACECS Blocking Peptide, ACS Blocking Peptide, ACSA Blocking Peptide, DKFZp762G026 Blocking Peptide, dJ1161H23.1 Blocking Peptide, ACSS2, ACSS-2, ACSS 2, ACSS-2 Blocking Peptide, ACSS 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNV
Molecular Weight 66 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors