ACTR2 antibody (70R-1197)

Rabbit polyclonal ACTR2 antibody

Synonyms Polyclonal ACTR2 antibody, Anti-ACTR2 antibody, Arp2 Actin-Related Protein 2 Homolog antibody, ARP2 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE
Assay Information ACTR2 Blocking Peptide, catalog no. 33R-6704, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody


Immunohistochemical staining using ACTR2 antibody (70R-1197)

ACTR2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACTR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ACTR2 antibody (70R-1197) | ACTR2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ACTR2 antibody (70R-1197) | ACTR2 antibody (70R-1197) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using ACTR2 antibody (70R-1197) | ACTR2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows] in Human Muscle. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors