ADORA2A Blocking Peptide (33R-8416)
A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA2A antibody, catalog no. 70R-9944
Overview
Overview
| Synonyms | ADORA2A control peptide, ADORA2A antibody Blocking Peptide, Anti-ADORA2A Blocking Peptide, adenosine A2a receptor Blocking Peptide, ADORA2 Blocking Peptide, RDC8 Blocking Peptide, hA2aR Blocking Peptide, ADORA2A, ADORAA-2, ADORAA 2, ADORAA-2 Blocking Peptide, ADORAA 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFN |
|---|---|
| Molecular Weight | 45 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product