ADORA2A Blocking Peptide (33R-8416)

A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA2A antibody, catalog no. 70R-9944

Synonyms ADORA2A control peptide, ADORA2A antibody Blocking Peptide, Anti-ADORA2A Blocking Peptide, adenosine A2a receptor Blocking Peptide, ADORA2 Blocking Peptide, RDC8 Blocking Peptide, hA2aR Blocking Peptide, ADORA2A, ADORAA-2, ADORAA 2, ADORAA-2 Blocking Peptide, ADORAA 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFN
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors