ADRB1 Blocking Peptide (33R-1826)

A synthetic peptide for use as a blocking control in assays to test for specificity of ADRB1 antibody, catalog no. 70R-5939

Synonyms ADRB1 control peptide, ADRB1 antibody Blocking Peptide, Anti-ADRB1 Blocking Peptide, Adrenergic Beta-1- Receptor Blocking Peptide, ADRB1R Blocking Peptide, B1AR Blocking Peptide, BETA1AR Blocking Peptide, RHR Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Molecular Weight 51 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors