AGPAT2 antibody (70R-1770)

Rabbit polyclonal AGPAT2 antibody raised against the C terminal of AGPAT2

Synonyms Polyclonal AGPAT2 antibody, Anti-AGPAT2 antibody, LPAAB antibody, BSCL antibody, , 1-AGPAT2 antibody, 1-Acylglycerol-3-Phosphate O-Acyltransferase 2 antibody, LPAAT-beta antibody, BSCL1 antibody
Specificity AGPAT2 antibody was raised against the C terminal of AGPAT2
Cross Reactivity Human
Applications WB
Immunogen AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
Assay Information AGPAT2 Blocking Peptide, catalog no. 33R-4874, is also available for use as a blocking control in assays to test for specificity of this AGPAT2 antibody


Western Blot analysis using AGPAT2 antibody (70R-1770)

AGPAT2 antibody (70R-1770) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AGPAT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AGPAT2 antibody (70R-1770) | AGPAT2 antibody (70R-1770) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors