AGR2 antibody (70R-5443)

Rabbit polyclonal AGR2 antibody

Synonyms Polyclonal AGR2 antibody, Anti-AGR2 antibody, Anterior Gradient Homolog 2 antibody, GOB-4 antibody, AG2 antibody, HAG-2 antibody, XAG-2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen AGR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY
Assay Information AGR2 Blocking Peptide, catalog no. 33R-1144, is also available for use as a blocking control in assays to test for specificity of this AGR2 antibody

Images

Western blot analysis using AGR2 antibody (70R-5443)

Tissue analyzed: Fetal Muscle Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml; Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane Gel Concentration: 0.12%

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using AGR2 antibody (70R-5443) | Tissue analyzed: Fetal Muscle Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml; Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane Gel Concentration: 0.12%
  • Immunohistochemical staining using AGR2 antibody (70R-5443) | Colon

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors