AGTR1 antibody (70R-5938)
Rabbit polyclonal AGTR1 antibody raised against the N terminal of AGTR1
Overview
Overview
| Synonyms | Polyclonal AGTR1 antibody, Anti-AGTR1 antibody, AGTR -1 antibody, AGTR 1 antibody, AGTR -1, HAT1R antibody, AT2R1B antibody, AG2S antibody, AT2R1A antibody, AT1 antibody, AGTR1, AGTR1A antibody, AT1B antibody, AGTR 1, Angiotensin Ii Receptor Type 1 antibody, AGTR1B antibody, AT2R1 antibody |
|---|---|
| Specificity | AGTR1 antibody was raised against the N terminal of AGTR1 |
| Cross Reactivity | Human,Mouse,Rat,Dog |
| Applications | WB |
| Immunogen | AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
| Assay Information | AGTR1 Blocking Peptide, catalog no. 33R-4056, is also available for use as a blocking control in assays to test for specificity of this AGTR1 antibody |
Images
Western Blot analysis using AGTR1 antibody (70R-5938)
AGTR1 antibody (70R-5938) used at 1 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 41 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product