AGXT2L1 antibody (70R-2601)

Rabbit polyclonal AGXT2L1 antibody raised against the middle region of AGXT2L1

Synonyms Polyclonal AGXT2L1 antibody, Anti-AGXT2L1 antibody, Alanine-Glyoxylate Aminotransferase 2-Like 1 antibody
Specificity AGXT2L1 antibody was raised against the middle region of AGXT2L1
Cross Reactivity Human
Applications WB
Immunogen AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT
Assay Information AGXT2L1 Blocking Peptide, catalog no. 33R-4639, is also available for use as a blocking control in assays to test for specificity of this AGXT2L1 antibody


Western Blot analysis using AGXT2L1 antibody (70R-2601)

AGXT2L1 antibody (70R-2601) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AGXT2L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AGXT2L1 belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AGXT2L1 antibody (70R-2601) | AGXT2L1 antibody (70R-2601) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors