AHCY antibody (70R-2721)

Rabbit polyclonal AHCY antibody raised against the N terminal of AHCY

Synonyms Polyclonal AHCY antibody, Anti-AHCY antibody, S-Adenosylhomocysteine Hydrolase antibody, SAHH antibody
Specificity AHCY antibody was raised against the N terminal of AHCY
Cross Reactivity Human,Mouse
Applications WB
Immunogen AHCY antibody was raised using the N terminal of AHCY corresponding to a region with amino acids SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA
Assay Information AHCY Blocking Peptide, catalog no. 33R-8359, is also available for use as a blocking control in assays to test for specificity of this AHCY antibody


Western Blot analysis using AHCY antibody (70R-2721)

AHCY antibody (70R-2721) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHCY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AHCY antibody (70R-2721) | AHCY antibody (70R-2721) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors