AIFM3 antibody (70R-2470)

Rabbit polyclonal AIFM3 antibody raised against the middle region of AIFM3

Synonyms Polyclonal AIFM3 antibody, Anti-AIFM3 antibody, FLJ30473 antibody, Cell Cycle & Cell Death-Inducing Factor Mitochondrion-Associated 3 antibody, AIFL antibody
Specificity AIFM3 antibody was raised against the middle region of AIFM3
Cross Reactivity Human
Applications WB
Immunogen AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
Assay Information AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody


Western Blot analysis using AIFM3 antibody (70R-2470)

AIFM3 antibody (70R-2470) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AIFM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AIFM3 antibody (70R-2470) | AIFM3 antibody (70R-2470) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors