AK2 antibody (70R-3439)

Rabbit polyclonal AK2 antibody raised against the middle region of AK2

Synonyms Polyclonal AK2 antibody, Anti-AK2 antibody, ADK2 antibody, Adenylate Kinase 2 antibody
Specificity AK2 antibody was raised against the middle region of AK2
Cross Reactivity Human
Applications WB
Immunogen AK2 antibody was raised using the middle region of AK2 corresponding to a region with amino acids LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
Assay Information AK2 Blocking Peptide, catalog no. 33R-5044, is also available for use as a blocking control in assays to test for specificity of this AK2 antibody


Western Blot analysis using AK2 antibody (70R-3439)

AK2 antibody (70R-3439) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AK2 antibody (70R-3439) | AK2 antibody (70R-3439) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors