AK5 antibody (70R-3556)

Rabbit polyclonal AK5 antibody raised against the N terminal of AK5

Synonyms Polyclonal AK5 antibody, Anti-AK5 antibody, Adenylate Kinase 5 antibody, AK6 antibody, MGC33326 antibody
Specificity AK5 antibody was raised against the N terminal of AK5
Cross Reactivity Human
Applications WB
Immunogen AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY
Assay Information AK5 Blocking Peptide, catalog no. 33R-2721, is also available for use as a blocking control in assays to test for specificity of this AK5 antibody


Western Blot analysis using AK5 antibody (70R-3556)

AK5 antibody (70R-3556) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AK5 antibody (70R-3556) | AK5 antibody (70R-3556) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors