AKAP1 antibody (70R-5027)

Rabbit polyclonal AKAP1 antibody

Synonyms Polyclonal AKAP1 antibody, Anti-AKAP1 antibody, AKAP121 antibody, A-kinase anchoring protein 1 antibody, Prka Anchor Protein 1 antibody, PRKA1 antibody, MGC1807 antibody, AKAP antibody, D-AKAP1 antibody, SAKAP84 antibody, AKAP84 antibody, AKAP149 antibody
Cross Reactivity Human
Applications WB
Immunogen AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF
Assay Information AKAP1 Blocking Peptide, catalog no. 33R-9725, is also available for use as a blocking control in assays to test for specificity of this AKAP1 antibody


Western Blot analysis using AKAP1 antibody (70R-5027)

AKAP1 antibody (70R-5027) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AKAP1 antibody (70R-5027) | AKAP1 antibody (70R-5027) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors