AKAP5 antibody (70R-2558)

Rabbit polyclonal AKAP5 antibody

Synonyms Polyclonal AKAP5 antibody, Anti-AKAP5 antibody, AKAP antibody, H21 antibody, Prka Anchor Protein 5 antibody, A-kinase anchoring protein 5 antibody, AKAP79 antibody, AKAP75 antibody
Cross Reactivity Human
Applications WB
Immunogen AKAP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE
Assay Information AKAP5 Blocking Peptide, catalog no. 33R-4603, is also available for use as a blocking control in assays to test for specificity of this AKAP5 antibody

Western Blot analysis using AKAP5 antibody (70R-2558)

AKAP5 antibody (70R-2558) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKAP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP5 is a member of the AKAP family. It binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using AKAP5 antibody (70R-2558) | AKAP5 antibody (70R-2558) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors