AKAP7 antibody (70R-2689)

Rabbit polyclonal AKAP7 antibody

Synonyms Polyclonal AKAP7 antibody, Anti-AKAP7 antibody, AKAP antibody, AKAP18 antibody, Prka Anchor Protein 7 antibody, A-kinase anchoring protein 7 antibody
Cross Reactivity Human
Applications WB
Immunogen AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQV
Assay Information AKAP7 Blocking Peptide, catalog no. 33R-9178, is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Images

Western Blot analysis using AKAP7 antibody (70R-2689)

AKAP7 antibody (70R-2689) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AKAP7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AKAP7 antibody (70R-2689) | AKAP7 antibody (70R-2689) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors