AKR1B1 antibody (70R-1071)

Rabbit polyclonal AKR1B1 antibody

Synonyms Polyclonal AKR1B1 antibody, Anti-AKR1B1 antibody, MGC1804 antibody, AR antibody, Aldose Reductase antibody, Aldo-Keto Reductase Family 1 Member B1 antibody, ALDR1 antibody, ADR antibody, ALR2 antibody
Cross Reactivity Human
Applications WB
Immunogen AKR1B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
Assay Information AKR1B1 Blocking Peptide, catalog no. 33R-7728, is also available for use as a blocking control in assays to test for specificity of this AKR1B1 antibody


Western Blot analysis using AKR1B1 antibody (70R-1071)

AKR1B1 antibody (70R-1071) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AKR1B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AKR1B1 antibody (70R-1071) | AKR1B1 antibody (70R-1071) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors