AKR1B10 antibody (70R-1278)

Rabbit polyclonal AKR1B10 antibody

Synonyms Polyclonal AKR1B10 antibody, Anti-AKR1B10 antibody, AKR1B11 antibody, HSI antibody, AKR1B12 antibody, Aldose Reductase antibody, ARL1 antibody, HIS antibody, Aldo-Keto Reductase Family 1 Member B10 antibody, MGC14103 antibody, ALDRLn antibody, ARL-1 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
Assay Information AKR1B10 Blocking Peptide, catalog no. 33R-6669, is also available for use as a blocking control in assays to test for specificity of this AKR1B10 antibody


Western Blot analysis using AKR1B10 antibody (70R-1278)

AKR1B10 antibody (70R-1278) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of AKR1B10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AKR1B10 antibody (70R-1278) | AKR1B10 antibody (70R-1278) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors