ALAS2 antibody (70R-2453)

Rabbit polyclonal ALAS2 antibody raised against the C terminal of ALAS2

Synonyms Polyclonal ALAS2 antibody, Anti-ALAS2 antibody, ASB antibody, XLSA antibody, Aminolevulinate Delta- Synthase 2 antibody, ANH1 antibody
Specificity ALAS2 antibody was raised against the C terminal of ALAS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALAS2 antibody was raised using the C terminal of ALAS2 corresponding to a region with amino acids VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA
Assay Information ALAS2 Blocking Peptide, catalog no. 33R-9777, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody


Western Blot analysis using ALAS2 antibody (70R-2453)

ALAS2 antibody (70R-2453) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALAS2 specifies an erythroid-specific mitochondrially located enzyme. It catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALAS2 antibody (70R-2453) | ALAS2 antibody (70R-2453) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors