ALDH18A1 antibody (70R-2459)

Rabbit polyclonal ALDH18A1 antibody raised against the N terminal of ALDH18A1

Synonyms Polyclonal ALDH18A1 antibody, Anti-ALDH18A1 antibody, PYCS antibody, P5CS antibody, GSAS antibody, MGC117316 antibody, Aldehyde Dehydrogenase 18 Family Member A1 antibody
Specificity ALDH18A1 antibody was raised against the N terminal of ALDH18A1
Cross Reactivity Human
Applications WB
Immunogen ALDH18A1 antibody was raised using the N terminal of ALDH18A1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
Assay Information ALDH18A1 Blocking Peptide, catalog no. 33R-8914, is also available for use as a blocking control in assays to test for specificity of this ALDH18A1 antibody

Images

Western Blot analysis using ALDH18A1 antibody (70R-2459)

ALDH18A1 antibody (70R-2459) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH18A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALDH18A1 antibody (70R-2459) | ALDH18A1 antibody (70R-2459) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors