ALDH4A1 antibody (70R-1106)

Rabbit polyclonal ALDH4A1 antibody raised against the C terminal of ALDH4A1

Synonyms Polyclonal ALDH4A1 antibody, Anti-ALDH4A1 antibody, ALDH4 antibody, P5CDhS antibody, Aldehyde Dehydrogenase 4 Family Member A1 antibody, P5CD antibody, P5CDh antibody, P5CDhL antibody
Specificity ALDH4A1 antibody was raised against the C terminal of ALDH4A1
Cross Reactivity Human,Mouse,Dog,ZebraFish
Applications IHC, WB
Immunogen ALDH4A1 antibody was raised using the C terminal of ALDH4A1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI
Assay Information ALDH4A1 Blocking Peptide, catalog no. 33R-8071, is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody


Immunohistochemical staining using ALDH4A1 antibody (70R-1106)

ALDH4A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALDH4A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ALDH4A1 antibody (70R-1106) | ALDH4A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ALDH4A1 antibody (70R-1106) | ALDH4A1 antibody (70R-1106) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using ALDH4A1 antibody (70R-1106) | ALDH4A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: €296.37
Size: 100 ug
View Our Distributors