ALG2 Blocking Peptide (33R-7721)
A synthetic peptide for use as a blocking control in assays to test for specificity of ALG2 antibody, catalog no. 70R-2876
Overview
Overview
| Synonyms | ALG2 control peptide, ALG2 antibody Blocking Peptide, Anti-ALG2 Blocking Peptide, Asparagine-Linked Glycosylation 2 Homolog Blocking Peptide, S. Cerevisiae Alpha-13-Mannosyltransferase Blocking Peptide, CDGIi Blocking Peptide, FLJ14511 Blocking Peptide, hALPG2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product