ALG2 Blocking Peptide (33R-7721)

A synthetic peptide for use as a blocking control in assays to test for specificity of ALG2 antibody, catalog no. 70R-2876

Synonyms ALG2 control peptide, ALG2 antibody Blocking Peptide, Anti-ALG2 Blocking Peptide, Asparagine-Linked Glycosylation 2 Homolog Blocking Peptide, S. Cerevisiae Alpha-13-Mannosyltransferase Blocking Peptide, CDGIi Blocking Peptide, FLJ14511 Blocking Peptide, hALPG2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALG2 is a member of the glycosyltransferase 1 family. It acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors