ALKBH1 Blocking Peptide (33R-10376)
A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH1 antibody, catalog no. 70R-10379
Overview
Overview
| Synonyms | ALKBH1 control peptide, ALKBH1 antibody Blocking Peptide, Anti-ALKBH1 Blocking Peptide, alkB, alkylation repair homolog 1, E. coli Blocking Peptide, ABH Blocking Peptide, ABH1 Blocking Peptide, ALKBH Blocking Peptide, alkB Blocking Peptide, hABH Blocking Peptide, ALKBH1, ALKBH-1, ALKBH 1, ALKBH-1 Blocking Peptide, ALKBH 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQ |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product