ALKBH1 Blocking Peptide (33R-10376)

A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH1 antibody, catalog no. 70R-10379

Synonyms ALKBH1 control peptide, ALKBH1 antibody Blocking Peptide, Anti-ALKBH1 Blocking Peptide, alkB, alkylation repair homolog 1, E. coli Blocking Peptide, ABH Blocking Peptide, ABH1 Blocking Peptide, ALKBH Blocking Peptide, alkB Blocking Peptide, hABH Blocking Peptide, ALKBH1, ALKBH-1, ALKBH 1, ALKBH-1 Blocking Peptide, ALKBH 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQ
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors