ALKBH2 antibody (70R-4415)

Rabbit polyclonal ALKBH2 antibody

Synonyms Polyclonal ALKBH2 antibody, Anti-ALKBH2 antibody, MGC90512 antibody, Alkb Alkylation Repair Homolog 2 antibody, hABH2 antibody, ABH2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL
Assay Information ALKBH2 Blocking Peptide, catalog no. 33R-9735, is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody


Western Blot analysis using ALKBH2 antibody (70R-4415)

ALKBH2 antibody (70R-4415) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALKBH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALKBH2 antibody (70R-4415) | ALKBH2 antibody (70R-4415) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors