ALKBH8 antibody (70R-1459)

Rabbit polyclonal ALKBH8 antibody

Synonyms Polyclonal ALKBH8 antibody, Anti-ALKBH8 antibody, DEPC1 antibody, MGC118790 antibody, DEPC-1 antibody, ABH3 antibody, Alkb Alkylation Repair Homolog 8 antibody, PCA1 antibody, MGC118793 antibody, MGC118792 antibody
Cross Reactivity Human
Applications WB
Immunogen ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV
Assay Information ALKBH8 Blocking Peptide, catalog no. 33R-2365, is also available for use as a blocking control in assays to test for specificity of this ALKBH8 antibody


Western Blot analysis using ALKBH8 antibody (70R-1459)

ALKBH8 antibody (70R-1459) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALKBH8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALKBH8 antibody (70R-1459) | ALKBH8 antibody (70R-1459) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors