ALKBH8 antibody (70R-5009)

Rabbit polyclonal ALKBH8 antibody

Synonyms Polyclonal ALKBH8 antibody, Anti-ALKBH8 antibody, ABH8 antibody, Alkb Alkylation Repair Homolog 8 antibody, MGC10235 antibody, FLJ38204 antibody
Cross Reactivity Human
Applications WB
Immunogen ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG
Assay Information ALKBH8 Blocking Peptide, catalog no. 33R-5870, is also available for use as a blocking control in assays to test for specificity of this ALKBH8 antibody


Western Blot analysis using ALKBH8 antibody (70R-5009)

ALKBH8 antibody (70R-5009) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALKBH8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA and catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ALKBH8 antibody (70R-5009) | ALKBH8 antibody (70R-5009) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors