ALOX15B antibody (70R-1635)

Rabbit polyclonal ALOX15B antibody raised against the C terminal of ALOX15B

Synonyms Polyclonal ALOX15B antibody, Anti-ALOX15B antibody, Arachidonate 15-Lipoxygenase Type B antibody
Specificity ALOX15B antibody was raised against the C terminal of ALOX15B
Cross Reactivity Human
Applications WB
Immunogen ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR
Assay Information ALOX15B Blocking Peptide, catalog no. 33R-1552, is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody

Images

Western Blot analysis using ALOX15B antibody (70R-1635)

ALOX15B antibody (70R-1635) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ALOX15B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ALOX15B antibody (70R-1635) | ALOX15B antibody (70R-1635) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors