alpha Actinin 2 antibody (70R-1068)

Rabbit polyclonal alpha Actinin 2 antibody raised against the C terminal of ACTN2

Synonyms Polyclonal alpha Actinin 2 antibody, Anti-alpha Actinin 2 antibody, ACTN2 antibody
Specificity Alpha Actinin 2 antibody was raised against the C terminal of ACTN2
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen alpha Actinin 2 antibody was raised using the C terminal of ACTN2 corresponding to a region with amino acids VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD
Assay Information Alpha Actinin 2 Blocking Peptide, catalog no. 33R-9587, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 2 antibody

Images

Western Blot analysis using Alpha Actinin 2 antibody (70R-1068)

Alpha Actinin 2 antibody (70R-1068) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ACTN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Alpha Actinin 2 antibody (70R-1068) | Alpha Actinin 2 antibody (70R-1068) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors